PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004267.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB_related
Protein Properties Length: 1290aa    MW: 140367 Da    PI: 5.7847
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004267.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.7e-10446488347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
       Do004267.1 446 PWTQEEKEIFMEMLAKFGKH-FSKISSFLT-HKTTADCVEFYYKH 488
                      8*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-14432491IPR009057Homeodomain-like
PROSITE profilePS5129314.742442493IPR017884SANT domain
SMARTSM007177.8E-10443491IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-8444490IPR009057Homeodomain-like
PfamPF002498.4E-8445488IPR001005SANT/Myb domain
PROSITE profilePS5129312.545635686IPR017884SANT domain
SMARTSM007172.2E-6636684IPR001005SANT/Myb domain
SuperFamilySSF466897.8E-9639686IPR009057Homeodomain-like
CDDcd001677.35E-5640678No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1290 aa     Download sequence    Send to blast
LTANTGTDPT KDVPEADDKV FNNEFSIELD QLGDDHINSL ASILTDLLQH DDSCSGDSKG  60
ATSTSKLLLL KESISKEIEK AELEIDSLEG ELKSVNTEAG TAVEGSPTGI TYAENLSPSS  120
GTSKVPLSVE IYEMSNVMKE PGEIIASPKV PVAQDADIKG VDMMEIETAP VRNAKTVSSE  180
ESAVSPGVAD GPACAAADLS PLKASEGVGS QNGMDNDRLE TSPCHVNADS IKTEVSDDLP  240
VRQCSHHDHK HSLFGSVTSA NNDMAKVMNE SLFKSLPADT SRLDLLASSY LLSQRKNDLI  300
IRERLGVQKN RLRLKEQILT IKFKAYRHLW KEDLRLLSAK KQRSKSNKRI DQSNRMSHIG  360
SQRQRSSNRS RLAMPAGNLS SFSTPEMSDV ASKLFSEFQI KRCRNYLKMP ALIIDEKEKE  420
CSRFVSKNGL VDDPVLVEKE RVMINPWTQE EKEIFMEMLA KFGKHFSKIS SFLTHKTTAD  480
CVEFYYKHHK SDSFREVRKL LDLRQQQPTS NYLGAKSGKK WNPEANAASL DMLGVASVAA  540
AHGLEYANRV DKISAKSLIQ TAYGSNLPLH ERESVAADVL AGICGTLSPE GMGSCITSSA  600
DPGQKIMTRM EHVLAPEIDR SIDEEDTLSD QECEVDPVDW NDDEKSIFIE AMNSYGKDFA  660
RISSCVKSKS YEQCKVFFSK ARKSLGLDLI HQGAADVSMP TSDTNGGRSD NDEACAAEMD  720
SAPCSPRSCS KIEMDICPSG GPNSDIISKQ PEGNISNECD VVDVKTEEDE KKADKNCSII  780
DHKGVDEGTD QAACVPIDIN CPERTEKLQG TDDVVDQVNM HNNSSINSST EQALVAHSEV  840
RSSLQSIEVL KTNKSPVGIG TDASRMGECS PHALDNKLMK AGNPGFSGCI ASESCIIKDS  900
IRFANMTGAS TISPAFAPSY QHSAPTDMPP TKPKPPVTPL TPKDLMPVQF SSAVPDPTAI  960
RFDGITSITT PSFEDSGNRV SSALGAKDRS KYPAFKDPPG NQHDTLFRDI DGYTNHLTAE  1020
LPIFSERTSS PVSTSQTDRF TLTKFQNGRS SSLGLPNTSD GIQWARKHEE VLHGSLRPCS  1080
RNKSSEGDEQ QKRPGDVKLF GKILSHQSSL QSSGPSCNGS KSKPSSQNID ISSVRLLNNP  1140
RDRVVCSSRP GITPHLGLDE RTVRSYGHLD GTTTQPEPLL VMAKCQSLAG VPFYSAKNGT  1200
LGVFSDYQQP SMQPHQSDPK RLERFSDPQK RNGMELISGF QQPGKISRFG GAGILVSGVS  1260
DPVAALKAQY GPGSKVMGSD MDPWKDIGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C5e-15404495494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D5e-15404495494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1339345KKQRSKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK3Z3350.0K3Z335_SETIT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-80MYB family protein